BIMI Record Checker

BIMI can display your brand logo in supporting inboxes (requires strong DMARC and often VMC).

Result for sweepersamchimneysweepingservices.com

Not Found

FAQ

What is BIMI used for?
It helps show a verified brand logo in inboxes that support BIMI.
Do I need DMARC for BIMI?
Most providers require DMARC enforcement (p=quarantine or p=reject).
Where is the BIMI record published?
TXT record on default._bimi.<domain>.
Why is BIMI not showing after setup?
It can take time, and some providers require a VMC certificate.
What logo format should I use?
Typically SVG with strict requirements; always use HTTPS URL.

What is BIMI?

BIMI is a DNS TXT record that points to your brand logo. Many providers require DMARC enforcement (p=quarantine or p=reject).

Example

v=BIMI1; l=https://example.com/logo.svg; a=https://example.com/vmc.pem

Common mistakes

  • DMARC is not enforced (p=none) - many inboxes will not show BIMI.
  • Logo URL not HTTPS or wrong SVG format.
  • Missing VMC when required by provider.