DKIM Record Checker
DKIM signs outgoing emails. Receivers verify the signature using a public key in DNS.
DKIM lives on <selector>._domainkey.<domain>. If selector is empty, we try common ones.
Result for sweepersamchimneysweepingservices.com
Not Found
No DKIM record found for the checked selector(s). Ask your email provider which selector you should use.
FAQ
Why does DKIM require a selector?
Selectors allow rotating keys and running multiple keys per domain.
Where is DKIM published?
TXT on <selector>._domainkey.<domain>.
DKIM record exists but emails still fail DKIM?
Signing may be disabled or the selector used in email differs from DNS.
Do I need DKIM if I have SPF?
Yes, many providers use both for best deliverability and DMARC alignment.
Can I have multiple DKIM selectors?
Yes, that is common for key rotation or multiple senders.
What is DKIM?
DKIM (DomainKeys Identified Mail) adds a cryptographic signature to outgoing emails. DNS stores a public key that allows receivers to verify authenticity.
Example
v=DKIM1; k=rsa; p=MIIBIjANBgkqhkiG9w0B...
Common mistakes
- Wrong selector (the record exists but under a different selector).
- Key is split incorrectly across multiple TXT chunks (some DNS UIs break it).
- Publishing DKIM but not enabling signing on the mail provider.