DMARC Record Checker

DMARC builds on SPF and DKIM and tells receivers what to do with unauthenticated mail.

Result for giftcardsandmerchsweepstakes.com

Not Found

No DMARC record found on _dmarc.giftcardsandmerchsweepstakes.com.

FAQ

Do I need DMARC if I already have SPF?
Yes, DMARC ties SPF and DKIM together and adds enforcement and reporting.
Where should DMARC be published?
As a TXT record on _dmarc.yourdomain.com.
What does p=none mean?
Monitoring mode - you collect reports but do not enforce policy.
Can I set p=reject immediately?
Better to start with p=none, fix alignment, then move to quarantine/reject.
Why am I not receiving DMARC reports?
Check that rua= is valid, reachable, and your mailbox accepts reports.

What is DMARC?

DMARC is a TXT record on _dmarc.domain like v=DMARC1; p=.... It helps prevent spoofing and enables reporting.

Examples

Common mistakes

  • Missing policy tag p=.
  • Using invalid email in rua= or forgetting mailto:.
  • Setting p=reject before SPF/DKIM are aligned for all senders.