DMARC Record Checker
DMARC builds on SPF and DKIM and tells receivers what to do with unauthenticated mail.
Result for sweepersamchimneysweepingservices.com
Not Found
No DMARC record found on _dmarc.sweepersamchimneysweepingservices.com.
FAQ
Do I need DMARC if I already have SPF?
Yes, DMARC ties SPF and DKIM together and adds enforcement and reporting.
Where should DMARC be published?
As a TXT record on _dmarc.yourdomain.com.
What does p=none mean?
Monitoring mode - you collect reports but do not enforce policy.
Can I set p=reject immediately?
Better to start with p=none, fix alignment, then move to quarantine/reject.
Why am I not receiving DMARC reports?
Check that rua= is valid, reachable, and your mailbox accepts reports.
What is DMARC?
DMARC is a TXT record on _dmarc.domain like v=DMARC1; p=.... It helps prevent spoofing and enables reporting.
Examples
- v=DMARC1; p=none; rua=mailto:[email protected] - monitoring mode.
- v=DMARC1; p=quarantine; pct=100; rua=mailto:[email protected] - quarantine failures.
- v=DMARC1; p=reject; rua=mailto:[email protected] - strongest enforcement.
Common mistakes
- Missing policy tag p=.
- Using invalid email in rua= or forgetting mailto:.
- Setting p=reject before SPF/DKIM are aligned for all senders.