MX Record Checker

MX records define which mail servers receive email for your domain.

Result for sweepersamchimneysweepingservices.com

Not Found

No MX records found (the domain may not receive email).

FAQ

What are MX records?
They define which servers receive inbound email for a domain and their priority order.
Do I need MX records?
Only if you want to receive email on this domain. Sending can work without MX depending on provider.
Why is Exchange shown as “.”?
Some configurations use a null MX (RFC 7505) to explicitly disable email receiving.
Should I have multiple MX servers?
Usually yes for redundancy, unless your provider explicitly uses one.
How long does DNS change take?
Propagation depends on TTL and caching; typically minutes to hours.

Common mistakes

  • MX points to a hostname without an A/AAAA record.
  • Using CNAME for MX target (not recommended).
  • Wrong priorities or only one server without redundancy.