SPF Record Checker

SPF helps prevent spoofing by declaring which servers are allowed to send mail for your domain.

Result for sweepersamchimneysweepingservices.com

Not Found

No SPF TXT record found on the root domain.

FAQ

What does SPF do?
It tells receiving mail servers which senders are authorized for your domain.
Should I have more than one SPF record?
No, you should publish a single SPF record on the root domain.
What is the difference between ~all and -all?
~all is softfail, -all is hard fail (recommended once configuration is correct).
Why is SPF valid but emails still go to spam?
You also need DKIM and DMARC alignment, plus good sending reputation.
How long does SPF change take?
Depends on DNS TTL and caches, usually minutes to hours.

What is SPF?

SPF is a TXT record like v=spf1 ... that tells receiving mail servers which IPs/providers are allowed to send emails for your domain.

Examples

  • v=spf1 a mx -all - allow servers from A and MX records; deny all others.
  • v=spf1 include:_spf.google.com -all - Google Workspace sending only.
  • v=spf1 include:spf.protection.outlook.com -all - Microsoft 365 sending only.

Common mistakes

  • Multiple SPF records on the same domain (should be one).
  • Too many DNS lookups (SPF has a 10-lookup limit).
  • Using ~all forever (softfail) instead of tightening to -all once ready.