TLS-RPT Checker

TLS-RPT lets mail servers report TLS delivery issues to you.

Result for sweepersamchimneysweepingservices.com

Not Found

FAQ

What is TLS-RPT used for?
It provides reports about TLS delivery failures for inbound email to your domain.
Where is the TLS-RPT record?
TXT record on _smtp._tls.<domain>.
Do I need MTA-STS to use TLS-RPT?
No, but using both is recommended.
Can I use https reporting endpoint?
Yes, TLS-RPT supports mailto and https URIs depending on receiver support.
Why do I get no reports?
Reports are sent only when failures occur and only by participating senders.

What is TLS-RPT?

TLS-RPT (SMTP TLS Reporting) is a TXT record that tells senders where to send reports about TLS failures when delivering email to your domain.

Example

v=TLSRPTv1; rua=mailto:[email protected]

Common mistakes

  • Missing rua= destination.
  • Using invalid mailto URI.
  • Publishing record but not monitoring reports.