TLS-RPT Checker
TLS-RPT lets mail servers report TLS delivery issues to you.
Result for sweepersamchimneysweepingservices.com
Not Found
FAQ
What is TLS-RPT used for?
It provides reports about TLS delivery failures for inbound email to your domain.
Where is the TLS-RPT record?
TXT record on _smtp._tls.<domain>.
Do I need MTA-STS to use TLS-RPT?
No, but using both is recommended.
Can I use https reporting endpoint?
Yes, TLS-RPT supports mailto and https URIs depending on receiver support.
Why do I get no reports?
Reports are sent only when failures occur and only by participating senders.
What is TLS-RPT?
TLS-RPT (SMTP TLS Reporting) is a TXT record that tells senders where to send reports about TLS failures when delivering email to your domain.
Example
v=TLSRPTv1; rua=mailto:[email protected]
Common mistakes
- Missing rua= destination.
- Using invalid mailto URI.
- Publishing record but not monitoring reports.